{ { "initiatorBinding" : true, "actions" : [ )*safari/i.test(navigator.userAgent)) { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" Ensure that PoE is enabled on the switch port connected to the PoE device. "messageViewOptions" : "1111110111111111111110111110100101011101", ] ] "actions" : [ "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "context" : "", "initiatorBinding" : true, "event" : "expandMessage", "viewOrderSpec" : "xOuk74OUAchWkLrDR43wT3yXFRUnE_zAck_aXweQ3NfTLAC6dHjeaYd7qwIztQyaSMN7KWFwmFB0RHqOrpqjND7fYqMoI9cIK2IieHFh3-71iKp2nDII2QfyZAEPmy8wtXOdhwXRmpRy7aaCNipdFeahr9ZqV6UOeGp5nXNDyNChmiMq_4RfiEXD8_I5jfbaOmgZVk48HNne0Gaks7krnonef0FNao0SJiSDC2qqdjwIjJmsu-0V6yf0NbyRM0ETTCuL5rIlZu4ZBpGeKptN9359GkkfFNACJURQT60loFOrPLkhycC2X_JAV0ZbqaFeQUmMaONTly0pf38I-Um-HOevkg3TGuN6RfA7rv8qUXTriruBCNld375_byzszJap0XLqK4ee4FsuDxg57Od7YrWhCloCwQ35XKzVA5B4dwTs6pTS3NzaMIeCGin4cr4-ADAsqBycyZOes21K3dbmm0nnYjchEsicqujk4UoszuOmQu4ryDwWfKSRJDlsYS_uWvnBOg-rtZhnxgExJTH1E4FQ29NogAYLRn3aN1ghFAw." { "event" : "addMessageUserEmailSubscription", { "context" : "envParam:quiltName,message", }, } "context" : "envParam:quiltName", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", { Is there a way to view LLDP or CDP neighbours on an MX device? { }, ] "context" : "", ] } }, ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "markAsSpamWithoutRedirect", "action" : "rerender" ] "actions" : [ "context" : "", } "actions" : [ "action" : "rerender" "action" : "pulsate" ], "event" : "MessagesWidgetEditAction", { "kudosable" : "true", }, "event" : "MessagesWidgetEditAction", LITHIUM.Loader.runJsAttached(); { "entity" : "29619", ] "quiltName" : "ForumMessage", } "actions" : [ } "actions" : [ "action" : "rerender" "context" : "envParam:feedbackData", { "event" : "MessagesWidgetEditCommentForm", } "action" : "rerender" { ] ] "actions" : [ "event" : "QuickReply", "context" : "", } ] "context" : "envParam:quiltName", "action" : "rerender" }, The domain name that you get in show cdp nei detail" command is VTP domain name of the adjacent switch. ] { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, '2Nx7zKIPxkljFawDyVWdfOensCuYFZprHYNuL_D4mF4. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { { ] "initiatorDataMatcher" : "data-lia-message-uid" "kudosLinksDisabled" : "false", "action" : "rerender" https://dashboard.meraki.com/api_docs#list-lldp-and-cdp-information-for-a-device. "includeRepliesModerationState" : "true", /meraki configure-basic-access-port [org-name] [device-name] [port-number] [enabled] [vlan] [port-desc]: Configure an access port with description, VLAN and state. "action" : "rerender" "disableLabelLinks" : "false", ] { ] { { { "actions" : [ }, "actions" : [ } }, } Use the interface configuration command no cdp enable to disable CDP on a specific interface: RouterOrSwitch (config)#interface fastethernet 0/1. "}); "context" : "", "action" : "rerender" "event" : "unapproveMessage", "actions" : [ LITHIUM.Text.set({"ajax.reRenderInlineEditor.loader.feedback.title":"Loading"}); "event" : "approveMessage", "action" : "rerender" { "action" : "rerender" "actions" : [ }, }, "initiatorDataMatcher" : "data-lia-kudos-id" "disallowZeroCount" : "false", }, }, { "truncateBodyRetainsHtml" : "false", { } "action" : "rerender" }, "event" : "RevokeSolutionAction", { SAN storage management. This frame is being multicast in every 60 seconds. } You can verify whether CDP is enabled or disabled on your Cisco device using the show cdp neighbors command. }, "useSubjectIcons" : "true", "parameters" : { "action" : "pulsate" LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'kklYZlNiT6SnwZr1I5N-sWYpatlIXSzAXARzkaLaR8w. "disableLinks" : "false", "}); "actions" : [ } } "}); "event" : "kudoEntity", } show cdp neighbors and show lldp neighbors to quickly check the list of neighbors; show cdp neighbors details to find out the IP address of each neighbor; Pursuing the CCNA with our Free CCNA course is a lot like building a house. { { "event" : "expandMessage", "context" : "", It can be run on both routers and switches, and it displays detailed information about each device. "componentId" : "kudos.widget.button", "action" : "rerender" Link Layer Discovery Protocol (LLDP) is a layer 2 protocol used to provide automatic discovery of connected devices and their capabilities. "initiatorBinding" : true, }, ] LITHIUM.AjaxSupport.ComponentEvents.set({ }, The Solution. Are you sure you want to proceed? "truncateBodyRetainsHtml" : "false", } { This one, along with other basic port level statistics, are something I would like to see. Are you sure you want to proceed? "action" : "rerender" ] "action" : "rerender" { { }, Get notified when there are additional replies to this discussion. "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "componentId" : "forums.widget.message-view", LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "displaySubject" : "true" "context" : "", ], } "actions" : [ { }, { "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"KJBDkliP-zcxxmjsg3-Dg4dR091LUa0tn5fydeORaHI. { { { ] "event" : "ProductAnswerComment", Are you sure you want to proceed? }, "event" : "ProductMessageEdit", (See screen shot below). LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "action" : "rerender" "includeRepliesModerationState" : "true", ], $(document).on('mouseup', function(e) { { "action" : "rerender" "displaySubject" : "true" "actions" : [ "displaySubject" : "true" ] }, { "actions" : [ }, } }, ], }, { "event" : "AcceptSolutionAction", "disableLabelLinks" : "false", { ] "event" : "deleteMessage", ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); }, }, Are you sure you want to proceed? "context" : "envParam:quiltName,message,product,contextId,contextUrl", Need to find network devices but not want to open SSH and do show cdp nei, show lldp nei and then need to sh cdp nei gig0/1 det and more.. ? "}); { "context" : "", { { "event" : "MessagesWidgetEditAction", ], }, } { Output will look similar to this (Output is from a 9800CL) I didn't realize how clean the 9800 AP CDP command would look like. "actions" : [ } { "actions" : [ ] } }, }, { "useCountToKudo" : "false", "action" : "rerender" ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,expandedQuiltName", "event" : "ProductAnswerComment", } "event" : "removeMessageUserEmailSubscription", "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", CDP is a Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do work with it. "event" : "MessagesWidgetAnswerForm", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { }, is there a way for the output to show hostnames of the neighbors instead? } }, "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "includeRepliesModerationState" : "true", }, "useSubjectIcons" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl",